home Startseite arrow_back zurück

  • Intranet für Studierende und Mitarbeitende

  • north_east Forschungsinformationssystem (FIS)

  • north_east Jobbörse

  • north_east Mensa

  • north_east mySpoho

  • Personenverzeichnis

  • north_east Spohoshop

  • Zentralbibliothek
home Startseite arrow_back zurück

  • Universität

    • Universität

    • Profil

      • Profil

      • Porträt

      • Unser Leitbild

      • Zahlen und Fakten

      • Auszeichnungen und Preise

      • Gleichstellung und Diversität

        • Gleichstellung und Diversität

        • Karriereförderung für Frauen

      • Nachhaltigkeit und Umweltschutz

      • International

        • International

        • Hochschulpartnerschaften

      • Partnerschaften und Kooperationen

        • Partnerschaften und Kooperationen

        • Kooperationsmöglichkeiten

    • Organisation

      • Organisation

      • Hochschulleitung

        • Hochschulleitung

        • Das Rektorat

          • Das Rektorat

          • Amtliche Mitteilungen

        • Der Senat

        • Der Hochschulrat

      • Verwaltung und Stabsstellen

      • Organe und Gremien

        • Organe und Gremien

        • Universitätskommissionen

        • Gleichstellungskommission

        • Nachhaltigkeitskommission

        • Ethikkommission

        • Prüfungsausschüsse

        • Promotionsausschuss

        • Habilitationsausschuss

      • Institute und wissenschaftliche Einrichtungen

      • Anlaufstellen und Services

        • Anlaufstellen und Services

        • Ambulanz

        • Career Service

        • Familienservice

        • Gästehaus

        • InfoPoint

        • International Office

        • Marketing

          • Marketing

          • Spohoshop

        • Presse und Kommunikation

        • Prüfungsamt

        • Studienberatung

        • Studierendensekretariat

        • Zentrale Betriebseinheit Informationstechnologie

      • Personenverzeichnis

    • Die Uni als Arbeitgeberin

      • Die Uni als Arbeitgeberin

      • Unsere Stellenangebote

      • Praktikum

        • Praktikum

        • Übersicht Praktikumsstellen

      • Personalentwicklung

      • Gesundheitsmanagement

    • Campusleben

      • Campusleben

      • Sport und Kultur

      • Wohnen und Übernachten

    • Newsroom

      • Newsroom

      • Podcast

        • Podcast

        • Wissenschaftspodcast Eine Runde mit

        • Studierendenpodcast Auszeit

      • Termine & Veranstaltungen

      • Meldungen

        • Meldungen

        • Pressemitteilungen

      • Publikationen

        • Publikationen

        • Campusmagazin ZeitLupe

          • Campusmagazin ZeitLupe

          • Sport und Ernährung

          • Olympische Spiele in Köln?

          • Gefahr im Gedränge

          • Darts - Ist das wirklich Sport?

        • Jahresbericht KOMPAKT

        • ZSLS

          • ZSLS

          • Hinweise für Autor*innen

          • Aktuelles

          • Impressum

      • Presseverteiler

      • Proband*innennewsletter

      • Pressespiegel

  • Studium

    • Studium

    • Vor dem Studium

      • Vor dem Studium

      • Veranstaltungen für Studieninteressierte

      • Bachelorstudium

        • Bachelorstudium

        • Sport- und Bewegungsvermittlung in Freizeit- und Breitensport

        • Sport und Gesundheit in Prävention und Therapie

        • Sportjournalismus

        • Sportmanagement und Sportkommunikation

        • Sport und Leistung

      • Masterstudium

        • Masterstudium

        • M.Sc. Sporttourismus und Destinationsmanagement

        • M.A. Sport-, Medien- und Kommunikationsforschung

        • M.Sc. Sport- und Bewegungstherapie, Prävention und bewegungsbezogene Gesundheitsforschung

        • M.Sc. Leistung, Training und Coaching im Spitzensport

        • M.Sc. Human Technology in Sports and Medicine

        • M.Sc. Psychology in Sport and Exercise

        • M.Sc. Sport Management

        • M.A. International Sport Development and Politics

      • Lehramtsstudium

        • Lehramtsstudium

        • Lehramt an Gymnasien und Gesamtschulen

        • Lehramt an Grundschulen

        • Lehramt an Haupt-, Real-, Sekundar- und Gesamtschulen

        • Lehramt an Berufskollegs

        • Lehramt für sonderpädagogische Förderung

      • Weiterbildendes Master­studium

        • Weiterbildendes Master­studium

        • Führungskompetenz und Management im Spitzensport

          • Führungskompetenz und Management im Spitzensport

          • Voraussetzungen und Bewerbung

        • Olympic Studies

          • Olympic Studies

          • Voraussetzungen und Bewerbung

          • Curriculum & Module

        • M.A. Spielanalyse

          • M.A. Spielanalyse

          • Voraussetzungen und Bewerbung

        • Tanz – Vermittlung, Forschung, künstlerische Praxis

          • Tanz – Vermittlung, Forschung, künstlerische Praxis

          • Zugangsvoraussetzungen, Bewerbung & Gebühren

        • Sport, Bewegung und Ernährung

          • Sport, Bewegung und Ernährung

          • Voraussetzungen und Bewerbung

        • Sportphysiotherapie

          • Sportphysiotherapie

          • Zugangsvoraussetzungen, Bewerbung und Gebühren

        • Schutz vor sexualisierter Gewalt und Machtmissbrauch in Organisationen

      • Campustag

      • Bewerbung

      • Voraussetzungen

        • Voraussetzungen

        • Eignungstest

        • Übetage

      • Immatrikulation

      • Studieren in besonderen Lebenslagen

        • Studieren in besonderen Lebenslagen

        • Studieren mit Kind oder Pflegeaufgaben

        • Studieren mit Behinderung oder chronischer Erkrankung

      • Studium und Spitzensport vereinen

      • Study@GSU

      • Gasthörerschaft

    • Während des Studiums

      • Während des Studiums

      • Veranstaltungen für Studierende

      • Anerkennung und Studiengangswechsel

      • Rückmeldung

      • Exmatrikulation

      • Next Career

    • Nach dem Studium

      • Nach dem Studium

      • Absolvent*innenfeier

      • Career Fitness Program

        • Career Fitness Program

        • Veranstaltungen

      • themenwochen

      • Alumni-Netzwerk

    • Studienstart Bachelor und Lehramt

    • Studienstart Master

    • Weiterbildung

    • In Köln studieren

      • In Köln studieren

      • Studienfinanzierung

        • Studienfinanzierung

        • Deutschlandstipendium

        • NRW-Sportstiftungs-Stipendium

    • Qualität in Studium und Lehre

      • Qualität in Studium und Lehre

      • Qualitätsmanagement

      • Feedback in Studium & Lehre

      • Lehrpreise und Förderprogramme

  • Forschung

    • Forschung

    • Forschungskultur

    • Institute und wissenschaftliche Einrichtungen

    • Wissenschaftliche Laufbahn

      • Wissenschaftliche Laufbahn

      • Promotion

        • Promotion

        • Promotionsstudium

      • Postdocs & Karriereentwicklung

      • Habilitation & Tenure Track

      • Professur

      • Interne Förderprogramme

    • Forschungs­management

      • Forschungs­management

      • Forschungsförderung

      • Forschungsinfrastruktur

      • Forschung international

      • Fit für Forschung und Transfer

      • Studien & Befragungen

        • Studien & Befragungen

        • Teilnehmende für eine Studie mit trans* Personen gesucht

        • Teilnehmende für Long-COVID-Studie gesucht

        • Wissenschaftliche Studie zu Ecdysteron, Muskelaufbau und Kraftentwicklung

        • Wie beeinflussen deine Zyklussymptome deine sportliche Leistungsfähigkeit und Trainingsbeteiligung?

        • Exoskelett-Forschung an der Deutschen Sporthochschule Köln

        • LEAP-Studie

        • Vorhersage der Sauerstoffaufnahme

        • Mechanoprotektive Mechanismen im Skelettmuskel

        • VR-Bewegungstraining

        • Golfen trotz Rückenschmerzen?

        • Relatives Energiedefizit im Sport (REDs)

        • Bewegung, Omega-3 und Curcumin

  • Transfer

    • Transfer

    • Innovationen aus der Forschung

      • Innovationen aus der Forschung

      • Transferberatung & Coaching

      • Transferförderung & Programme

      • Erfindungen, Patente & Schutzrechte

      • Transferprojekte & Initiativen

        • Transferprojekte & Initiativen

        • Sport und Schwangerschaft

        • mentaltalent

        • MentalGestärkt

        • Kinderonko

        • Schulsportlandschaft

          • Schulsportlandschaft

          • Podcast der Schulsportlandschaft

          • Videos & Kurzfilme

          • Tipps für den Schulalltag

          • Forschung, Projekte & Buchtipps

          • Fortbildungen & Veranstaltungen

          • Gimmicks

    • Gründung & Start-ups

      • Gründung & Start-ups

      • Gründungsberatung

      • Angebote & Förderungen

        • Angebote & Förderungen

        • StarS-Kader

        • Gateway EM*power

        • DSHS-Ideathlon

      • Unsere Start-ups

    • Weiterbildungsangebote
Filtern nach
Seiten close Person close News close Event close

4213 Ergebnisse
  • Relevanz
  • Alphabetisch
  • Erstellungsdatum

  • voraussetzungen_TSM.pdf
    Academic Management, Dept. 3.1 Prerequisites MA Prerequisites M.Sc. Human Technology in Sports and Medicine (TSM) Stand: February.2024 Subject to modifications M.Sc. Human Technology in Sports and Medicine (TSM) Module Prerequisites TSM1 Basics I - Mathematics & Physics No prerequisites TSM2 Basics II - Biomechanics No prerequisites TSM3 Basics III - Data management & -analysis No prerequisites TSM4 Basics IV - Material & construction No prerequisites TSM5 Technology I - Orthopaedic technologies No prerequisites TSM6 Technology II - Sport Biomechanics and Project Management No prerequisites TSM7 Technology III - Sports equipment and instrumentation No prerequisites TSM8 Technology IV - Modeling and simulation No prerequisites TSM9 Technology V - Diagnostics in Sports, Medicine and Rehabilitation No prerequisites TSM10 Philosophy of Science No prerequisites TSM11.1 Project I - Sports Technoloqy project No prerequisites TSM11.2 Project II - Medical Technology project No prerequisites TSM12 Internship No prerequisites TSM13 Master Thesis Modules from TSM1 to TSM11 completed M.Sc. Human Technology in Sports and Medicine (TSM)

  • voraussetzungen_biwi_LB_LM.pdf
    Stabsstelle Akademische Planung & Steuerung, Abt. 3.1 Modulvoraussetzungen Voraussetzungen im Lehramt Bildungswissenschaften (B.A. und M.Ed.) Stand: Februar 2024 Änderungen vorbehalten B.A. Lehramt Bildungswissenschaften (GymGe) Modul Voraussetzungen BFP Berufsfeldpraktikum Modul „Eignungs- und Orientierungspraktikum“ abgeschlossen BM3 Unterrichten Modul „Eignungs- und Orientierungspraktikum“ abgeschlossen M.Ed. Lehramt Bildungswissenschaften (GymGe) Modul Voraussetzungen PS Praxissemester Modul „Vorbereitung Praxissemester“ in allen Fächern abgeschlossen MM2 Diagnostik und Individuelle Förderung Veranstaltung „Allgemeine Vorbereitung Praxissemester (BiWi)“ im Modul VB PS erfolgreich teilgenommen B.A. Lehramt Bildungswissenschaften (GymGe) M.Ed. Lehramt Bildungswissenschaften (GymGe)

  • voraussetzungen_sport_LB_LM.pdf
    Stabsstelle Akademische Planung & Steuerung, Abt. 3.1 Modulvoraussetzungen Voraussetzungen im Lehramt Sport (B.A. und M.Ed.) Stand: Februar 2025 Änderungen vorbehalten B.A. Lehramt Sport Gym/Ge, HRSG, BK Modul Veranstaltung Voraussetzungen B6 Kurs: Gerätturnen Veranstaltung „Bewegen an Geräten“ im Modul B4 erfolgreich teilgenommen M.Ed. Lehramt Sport Gym/Ge, HRSG, BK, Grundschulen, Förderschulen Praxissemester Modul „Vorbereitung Praxissemester“ in allen Fächern abgeschlossen Für Studienanfänger*innen ab Wintersemester 2023/24: B.A. Lehramt Sport Gym/Ge, HRSG, BK Modul Veranstaltung Voraussetzungen B1 Übung: Qualitative/Quantitative Forschungsmethoden im Kontext von Schulsport Vorlesung „Grundlagen wissenschaftlichen Denkens und Arbeitens im Kontext von Schulsport“ im Modul B1 erfolgreich teilgenommen B6 Kurs: Gerätturnen Veranstaltung „Bewegen an Geräten“ im Modul B2 erfolgreich teilgenommen B.A. Lehramt Sport Gym/Ge, HRSG, BK M.Ed. Lehramt Sport Gym/Ge, HRSG, BK, Grundschulen, Förderschulen B.A. Lehramt Sport Gym/Ge, HRSG, BK

  • w_1920x1080_Profilbilder-Format_SBE.pdf
    Master

  • wachstumshormon_verbotsliste_detail_2021.pdf
    WADA Verbotsliste 2021, S2 Peptidhormone…/ 2.3 Growth Hormone ... (Änderungen zu 2020 in rot) Substanzname Struktur (bei Peptiden Aminosäuresequenz) AS Monoisotopische Masse [Da] Literatur Synonym 2.3 Growth Hormone (GH), its fragments and releasing factors, including, but not limited to: Growth Hormone fragments, e.g. GH 191 22111,04 www.drugbank.ca Somatropin, Somatotropin AOD‐9604 YLRIVQCRSVEGSCGF 16 1813,9 Ng 2000 hGH 176‐191 FLRIVQCRSVEGSCGF 16 1797,9 PubChem Somatropin (176‐191) Growth Hormone Releasing Hormone (GHRH) and its analogues GHRH YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL‐NH2 44 5036,7 Guillemin 1982 Somatoliberin CJC‐1293 YdADAIFTNSYRKVLGQLSARKLLQDIMSR‐NH2 29 3355,8 Knoop 2016 "GHRH (1‐29) aber, dA statt A" CJC‐1295 YdADAIFTQSYRKVLAQLSARKLLQDILSR‐NH2 29 3365,9 Knoop 2016 Sermorelin YADAIFTNSYRKVLGQLSARKLLQDIMSR‐NH2 29 3355,8 Knoop 2016 Geref, GHRH (1‐29) Tesamorelin hexenoyl‐YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL‐NH2 44 5132,7 Knoop 2016 Egrifta, "hexenoyl‐GHRH" Growth Hormone Secretagogues (GHS), e.g. lenomorelin (ghrelin) and ghrelin mimetics, Ghrelin GSXFLSPEHQRVQQRKESKKPPAKLQPR (X = Serin‐octyl) 28 3368,9 PubChem Anamorelin kein Peptid, C31H42N6O3 ‐ 546,332 PubChem ONO‐7643, RC‐1291 Ipamorelin Aib‐His‐(D‐ß‐Nal)‐(D‐Phe)‐Lys‐NH2 5 711,385 Thomas 2011 Macimorelin kein Peptid, C26H30N6O3 ‐ 474,238 Lange 2020 Macrilen, EP‐01572 Tabimorelin kein Peptid, C32H40N4O3 ‐ 528,310 PubChem, Lange 2020 NN‐703 GH‐Releasing Peptides (GHRPs), e.g. Alexamorelin Ala‐His‐(D‐Mrp)‐Ala‐Trp‐(D‐Phe)‐Lys‐NH2 7 957.497 Thomas 2011 GHRP‐1 Ala‐His‐(D‐ß‐Nal)‐Ala‐Trp‐(D‐Phe)‐Lys‐NH2 6 954.486 Thomas 2011 GHRP‐2 (pralmorelin) (D‐Ala)‐(D‐ß‐Nal)‐Ala‐Trp‐(D‐Phe)‐Lys‐NH2 6 817,427 Thomas 2011 GHRP‐3 Aib‐(D‐Trp)‐(D‐Pro)‐(D‐Ile)‐Arg‐NH2 4 654,400 Thomas 2016 GHRP‐4 (D‐Trp)‐Ala‐Trp‐(D‐Phe)‐NH2 4 607.292 Thomas 2011 GHRP‐5 Tyr‐(D‐Trp)‐Ala‐Trp‐(D‐Phe)‐NH2 5 770.354 Thomas 2011 GHRP‐6 His‐(D‐Trp)‐Ala‐Trp‐(D‐Phe)‐Lys‐NH2 6 872.444 Thomas 2011 Hexarelin His‐(D‐Mrp)‐Ala‐Trp‐(D‐Phe)‐Lys‐NH2 6 886.460 Thomas 2011 Nal = Naphthylalanine, Mrp = 2‐Methyltryptophane, Aib = Aminoisobutyric acid dA = D‐Alanin, AS = Anzahl Aminosäuren Bei Peptiden mit AS > 10 wurden für die Sequenz Symbole verwendet, ansonsten die Abkürzungen Guillemin R, Brazeau P, Böhlen P, Esch F, Ling N, Wehrenberg WB. Growth hormone‐releasing factor from a human pancreatic tumor that caused acromegaly. Science, 1982 Nov 5;218(4572):585‐7. Literatur PubChem, https://pubchem.ncbi.nlm.nih.gov/# Thomas A, Höppner S, Geyer H, Schänzer W, Petrou M, Kwiatkowska D, Pokrywka A, Thevis M Determination of growth hormone releasing peptides (GHRP) and their major metabolites in human urine for doping controls by means of liquid chromatography mass spectrometry Anal Bioanal Chem., 2011, 401, 507‐516 Thomas A, Görgens C, Guddat S, Thieme D, Delanna F, Schänzer W, Thevis M. Simplifying and expanding the screening for peptides

  • wada_2004_prohibited_list.pdf
    The World Anti-Doping Code THE 2004 PROHIBITED LIST INTERNATIONAL STANDARD (update 25 November 2003) This List shall come into effect on January 1st 2004. THE 2004 PROHIBITED LIST WORLD ANTI-DOPING CODE Valid 1st January 2004 (Updated 25 November 2003) SUBSTANCES AND METHODS PROHIBITED IN-COMPETITION PROHIBITED SUBSTANCES S1. STIMULANTS The following stimulants are prohibited, including both their optical (D- and L-) isomers where relevant: Adrafinil, amfepramone, amiphenazole, amphetamine, amphetaminil, benzphetamine, bromantan, carphedon, cathine*, clobenzorex, cocaine, dimethylamphetamine, ephedrine**, etilamphetamine, etilefrine, fencamfamin, fenetylline, fenfluramine, fenproporex, furfenorex, mefenorex, mephentermine, mesocarb, methamphetamine, methylamphetamine, methylenedioxyamphetamine, methylenedioxymethamphetamine, methylephedrine**, methylphenidate, modafinil, nikethamide, norfenfluramine, parahydroxyamphetamine, pemoline, phendimetrazine, phenmetrazine, phentermine, prolintane, selegiline, strychnine, and other substances with similar chemical structure or similar pharmacological effects***. * Cathine is prohibited when its concentration in urine is greater than 5 micrograms per millilitre. ** Each of ephedrine and methylephedrine is prohibited when its concentration in urine is greater than 10 micrograms per millilitre. *** The substances included in the 2004 Monitoring Program are not considered as Prohibited Substances. The Prohibited List 2004 25 November 2003 1 S2. NARCOTICS The following narcotics are prohibited: buprenorphine, dextromoramide, diamorphine (heroin), hydromorphone, methadone, morphine, oxycodone, oxymorphone, pentazocine, pethidine. S3. CANNABINOIDS Cannabinoids (e.g. hashish, marijuana) are prohibited. S4. ANABOLIC AGENTS Anabolic agents are prohibited. 1. Anabolic Androgenic Steroids (AAS) a. Exogenous* AAS including but not limited to: androstadienone, bolasterone, boldenone, boldione, clostebol, danazol, dehydrochloromethyltestosterone, delta1-androstene-3,17-dione, drostanolone, drostanediol, fluoxymesterone, formebolone, gestrinone, 4- hydroxytestosterone, 4-hydroxy-19-nortestosterone, mestanolone, mesterolone, methandienone, metenolone, methandriol, methyltestosterone, mibolerone, nandrolone, 19-norandrostenediol, 19-norandrostenedione, norbolethone, norethandrolone, oxabolone, oxandrolone, oxymesterone, oxymetholone, quinbolone, stanozolol, stenbolone, 1-testosterone (delta1-dihydro-testosterone), trenbolone and their analogues#. b. Endogenous** AAS including but not limited to: androstenediol, androstenedione, dehydroepiandrosterone (DHEA), dihydrotestosterone, testosterone and their analogues#. Where a Prohibited Substance (as listed above) is capable of being produced by the body naturally, a Sample will be deemed to contain such Prohibited Substance where the concentration of the Prohibited Substance or its metabolites or markers and/or any other relevant ratio(s) in the Athlete’s Sample so deviates from the range of values normally found in humans so as not to be consistent with normal endogenous production. A Sample shall not be deemed to contain a Prohibited Substance in any such case where the Athlete proves by evidence that the concentration of the Prohibited Substance or its metabolites or markers and/or the relevant ratio(s) in the Athlete’s Sample is attributable to a pathological or The Prohibited List 2004 25 November 2003 2 physiological condition. In all cases, and at any concentration, the laboratory will report an adverse finding if, based on any reliable analytical method, it can show that the Prohibited Substance is of exogenous origin. If the laboratory result is not conclusive and no concentration as referred to in the above paragraph is found, the relevant Anti-Doping Organization shall conduct a further investigation if there are serious indications, such as a comparison to reference steroid profiles, for a possible Use of a Prohibited Substance. If the laboratory has reported the presence of a T/E ratio greater than six (6) to one (1) in the urine, further investigation is obligatory in order to determine whether the ratio is due to a physiological or pathological condition. In both cases, the investigation will include a review of any previous tests, subsequent tests and/or results of endocrine investigations. If previous tests are not available, the Athlete shall undergo an endocrine investigation or be tested unannounced at least three times within a three month period. Failure of the Athlete to co-operate in the investigations will result in considering the Athlete’s Sample to contain a Prohibited Substance. 2. Other Anabolic Agents Clenbuterol, zeranol. For purposes of this section: * “exogenous” refers to a substance which is not capable of being produced by the body naturally. ** “endogenous” refers to a substance which is capable of being produced by the body naturally. # an "analogue" is defined as "a substance derived from the modification or alteration of the chemical structure of another substance while retaining a similar pharmacological effect.” The Prohibited List 2004 25 November 2003 3 S5. PEPTIDE HORMONES The following substances are prohibited, including their mimetics*, analogues# and releasing factors: 1. Erythropoietin (EPO) 2. Growth hormone (hGH) and Insulin-like Growth Factor (IGF-1) 3. Chorionic Gonadotrophin (hCG) prohibited in males only; 4. Pituitary and synthetic gonadotrophins (LH) prohibited in males only; 5. Insulin. 6. Corticotrophins Unless the Athlete can demonstrate that the concentration was due to a physiological or pathological condition, a Sample will be deemed to contain a Prohibited Substance (as listed above) where the concentration of the Prohibited Substance or its metabolites and/or relevant ratios or markers in the Athlete’s Sample so exceeds the range of values normally found in humans so as not to be consistent with normal endogenous production. The presence of analogues, mimetics, diagnostic marker(s) or releasing factors of a hormone listed above or of any other finding which indicate(s) that the substance detected is not the naturally present hormone, will be reported as an adverse analytical finding. For purposes of this section: * a “mimetic” is defined as a substance with pharmacological effect similar to that of another substance, regardless of the fact that it has a different chemical structure. # an "analogue" is defined as "a substance derived from the modification or alteration of the chemical structure of another substance while retaining a similar pharmacological effect.” The Prohibited List 2004 25 November 2003 4 S6. BETA-2 AGONISTS All beta-2 agonists including their D- and L- isomers are prohibited except that formoterol, salbutamol, salmeterol and terbutaline are permitted by inhalation only to prevent and/or treat asthma and exercise-induced asthma/broncho-constriction. A medical notification in accordance with section 8 of the International Standard for Therapeutic Use Exemptions is required. Despite the granting of a TUE, when the Laboratory has reported a concentration of salbutamol (free plus glucuronide) greater than 1000 ng/mL, this will be considered as an adverse analytical finding unless the athlete proves that the abnormal result was the consequence of the therapeutic use of inhaled salbutamol. S7. AGENTS WITH ANTI-OESTROGENIC ACTIVITY Aromatase inhibitors, clomiphene, cyclofenil, tamoxifen are prohibited only in males. S8. MASKING AGENTS Masking agents are prohibited. They are products that have the potential to impair the excretion of Prohibited Substances, to conceal their presence in urine or other Samples used in doping control, or to change haematological parameters. Masking agents include but are not limited to: Diuretics*, epitestosterone, probenecid, plasma expanders (e.g. dextran, hydroxyethyl starch.) *A medical approval in accordance with section 7 of the International Standard for Therapeutic Use Exemptions is not valid if an Athlete’s urine contains a diuretic in association with threshold or sub-threshold levels of a Prohibited Substance(s). Diuretics include : acetazolamide, amiloride, bumetanide, canrenone, chlortalidone, etacrynic acid, furosemide, indapamide, mersalyl, spironolactone, thiazides (e.g. bendroflumethiazide, chlorothiazide, hydrochlorothiazide) and triamterene, and other substances with similar chemical structure or similar pharmacological effects. S.9 GLUCOCORTICOSTEROIDS Glucocorticosteroids are prohibited when administered orally, rectally, or by intravenous or intramuscular administration. All other administration routes require a medical notification in accordance with section 8 of the International Standard for Therapeutic Use Exemptions. The Prohibited List 2004 25 November 2003 5 PROHIBITED METHODS M1. ENHANCEMENT OF OXYGEN TRANSFER The following are prohibited: a. Blood doping. Blood doping is the use of autologous, homologous or heterologous blood or red blood cell products of any origin, other than for legitimate medical treatment. b. The Use of products that enhance the uptake, transport or delivery of oxygen, e.g. erythropoietins, modified haemoglobin products including but not limited to haemoglobin-based blood substitutes, microencapsulated haemoglobin products, perfluorochemicals, and efaproxiral (RSR13). M2. PHARMACOLOGICAL, CHEMICAL AND PHYSICAL MANIPULATION Pharmacological, chemical and physical manipulation is the Use of substances and methods, including masking agents, which alter, attempt to alter or may reasonably be expected to alter the integrity and validity of specimens collected in doping controls. These include but are not limited to catheterisation, urine substitution and/or tampering, inhibition of renal excretion and alterations of testosterone and epitestosterone concentrations. M3. GENE DOPING Gene or cell doping is defined as the non-therapeutic use of genes, genetic elements and/or cells that have the capacity to enhance athletic performance. The Prohibited List 2004 25 November 2003 6 SUBSTANCES AND METHODS PROHIBITED IN- AND OUT-OF-COMPETITION PROHIBITED SUBSTANCES (All categories listed hereunder refer to all those substances and methods listed in the relevant section) S4. ANABOLIC AGENTS S5. PEPTIDE HORMONES S6. BETA-2 AGONISTS* S7. AGENTS WITH ANTI-OESTROGENIC ACTIVITY S8. MASKING AGENTS (*Only clenbuterol, and salbutamol when its concentration in urine is greater than 1000ng/mL) PROHIBITED METHODS M1. ENHANCEMENT OF OXYGEN TRANSFER M2. PHARMACOLOGICAL, CHEMICAL AND PHYSICAL MANIPULATION M3. GENE DOPING SUBSTANCES PROHIBITED IN PARTICULAR SPORTS P.1 ALCOHOL Alcohol (ethanol) is prohibited in-Competition only, in the following sports. Detection will be conducted by breath analysis and/or blood. The doping violation threshold for each Federation is reported in parenthesis. If no threshold is indicated, the presence of any quantity of alcohol shall constitute a doping violation. Aeronautic (FAI) (0.20 g/L) Archery (FITA) (0.10 g/L) Automobile (FIA) Billiards (WCBS) Boules (CMSB) (0.50 g/L) The Prohibited List 2004 25 November 2003 7 Football (FIFA) Gymnastics (FIG) (0.10 g/L) Karate (WKF) (0.40 g/L) Modern Pentathlon (UIPM) (0.10 g/L) for the modern pentathlon discipline Motorcycling (FIM) Roller Sports (FIRS) (0.02 g/L) Skiing (FIS) Triathlon (ITU) (0.40 g/L) Wrestling (FILA) P.2 BETA-BLOCKERS Unless otherwise specified, beta-blockers are prohibited in-Competition only, in the following sports. Aeronautic (FAI) Archery (FITA) (also prohibited out of competition) Automobile (FIA) Billiards (WCBS) Bobsleigh (FIBT) Boules (CMSB) Bridge (FMB) Chess (FIDE) Curling (WCF) Football (FIFA) Gymnastics (FIG) Motorcycling (FIM) Modern Pentathlon (UIPM) for the modern pentathlon discipline Nine-pin bowling (FIQ) Sailing (ISAF) match race helms only Shooting (ISSF) (also prohibited out of competition) Skiing (FIS) ski jumping & free style snow board Swimming (FINA) in diving & synchronised swimming Wrestling (FILA) Beta-blockers include, but are not limited to, the following: acebutolol, alprenolol, atenolol, betaxolol, bisoprolol, bunolol, carteolol, carvedilol, celiprolol, esmolol, labetalol, levobunolol, metipranolol, metoprolol, nadolol, oxprenolol, pindolol, propranolol, sotalol, timolol. The Prohibited List 2004 25 November 2003 8 P.3 DIURETICS Diuretics are prohibited in- and out- of competition in all sports as masking agents. However, in the following weight-classified sports and sports where weight loss can enhance performance, no Therapeutic Use Exemptions shall be granted for use of diuretics. Body-Building (IFBB) Boxing (AIBA) Judo (IJF) Karate (WKF) Powerlifting (IPF) Rowing (Light-Weight) (FISA) Skiing (FIS) for Ski Jumping only Taekwondo (WTF) Weightlifting (IWF) Wrestling (FILA) Wushu (IWUF) SPECIFIED SUBSTANCES* “Specified Substances” are listed below: Stimulants: ephedrine, L-methylamphetamine, methylephedrine. Cannabinoids. Inhaled Beta-2 Agonists (except clenbuterol). Diuretics (this does not apply to section P3). Masking Agents: probenecid. Glucocorticosteroids Beta Blockers Alcohol *; The WADA Code (10.3) states “The Prohibited List may identify specified substances which are particularly susceptible to unintentional anti-doping rule violations because of their general availability in medicinal products or which are less likely to be successfully abused as doping agents.” A doping violation involving such substances may result in a reduced sanction as noted in the Code provided that the “…Athlete can establish that the Use of such a specified substance was not intended to enhance sport performance…” The Prohibited List 2004 25 November 2003 9 THE 2004 PROHIBITED LIST S3. CANNABINOIDS Stimulants: ephedrine, L-methylamphetamine, methylephedrine. Cannabinoids. Inhaled Beta-2 Agonists (except clenbuterol). Diuretics (this does not apply to section P3). Masking Agents: probenecid. Beta Blockers Alcohol

  • wada_2004_prohibited_list.pdf
    The World Anti-Doping Code THE 2004 PROHIBITED LIST INTERNATIONAL STANDARD (update 25 November 2003) This List shall come into effect on January 1st 2004. THE 2004 PROHIBITED LIST WORLD ANTI-DOPING CODE Valid 1st January 2004 (Updated 25 November 2003) SUBSTANCES AND METHODS PROHIBITED IN-COMPETITION PROHIBITED SUBSTANCES S1. STIMULANTS The following stimulants are prohibited, including both their optical (D- and L-) isomers where relevant: Adrafinil, amfepramone, amiphenazole, amphetamine, amphetaminil, benzphetamine, bromantan, carphedon, cathine*, clobenzorex, cocaine, dimethylamphetamine, ephedrine**, etilamphetamine, etilefrine, fencamfamin, fenetylline, fenfluramine, fenproporex, furfenorex, mefenorex, mephentermine, mesocarb, methamphetamine, methylamphetamine, methylenedioxyamphetamine, methylenedioxymethamphetamine, methylephedrine**, methylphenidate, modafinil, nikethamide, norfenfluramine, parahydroxyamphetamine, pemoline, phendimetrazine, phenmetrazine, phentermine, prolintane, selegiline, strychnine, and other substances with similar chemical structure or similar pharmacological effects***. * Cathine is prohibited when its concentration in urine is greater than 5 micrograms per millilitre. ** Each of ephedrine and methylephedrine is prohibited when its concentration in urine is greater than 10 micrograms per millilitre. *** The substances included in the 2004 Monitoring Program are not considered as Prohibited Substances. The Prohibited List 2004 25 November 2003 1 S2. NARCOTICS The following narcotics are prohibited: buprenorphine, dextromoramide, diamorphine (heroin), hydromorphone, methadone, morphine, oxycodone, oxymorphone, pentazocine, pethidine. S3. CANNABINOIDS Cannabinoids (e.g. hashish, marijuana) are prohibited. S4. ANABOLIC AGENTS Anabolic agents are prohibited. 1. Anabolic Androgenic Steroids (AAS) a. Exogenous* AAS including but not limited to: androstadienone, bolasterone, boldenone, boldione, clostebol, danazol, dehydrochloromethyltestosterone, delta1-androstene-3,17-dione, drostanolone, drostanediol, fluoxymesterone, formebolone, gestrinone, 4- hydroxytestosterone, 4-hydroxy-19-nortestosterone, mestanolone, mesterolone, methandienone, metenolone, methandriol, methyltestosterone, mibolerone, nandrolone, 19-norandrostenediol, 19-norandrostenedione, norbolethone, norethandrolone, oxabolone, oxandrolone, oxymesterone, oxymetholone, quinbolone, stanozolol, stenbolone, 1-testosterone (delta1-dihydro-testosterone), trenbolone and their analogues#. b. Endogenous** AAS including but not limited to: androstenediol, androstenedione, dehydroepiandrosterone (DHEA), dihydrotestosterone, testosterone and their analogues#. Where a Prohibited Substance (as listed above) is capable of being produced by the body naturally, a Sample will be deemed to contain such Prohibited Substance where the concentration of the Prohibited Substance or its metabolites or markers and/or any other relevant ratio(s) in the Athlete’s Sample so deviates from the range of values normally found in humans so as not to be consistent with normal endogenous production. A Sample shall not be deemed to contain a Prohibited Substance in any such case where the Athlete proves by evidence that the concentration of the Prohibited Substance or its metabolites or markers and/or the relevant ratio(s) in the Athlete’s Sample is attributable to a pathological or The Prohibited List 2004 25 November 2003 2 physiological condition. In all cases, and at any concentration, the laboratory will report an adverse finding if, based on any reliable analytical method, it can show that the Prohibited Substance is of exogenous origin. If the laboratory result is not conclusive and no concentration as referred to in the above paragraph is found, the relevant Anti-Doping Organization shall conduct a further investigation if there are serious indications, such as a comparison to reference steroid profiles, for a possible Use of a Prohibited Substance. If the laboratory has reported the presence of a T/E ratio greater than six (6) to one (1) in the urine, further investigation is obligatory in order to determine whether the ratio is due to a physiological or pathological condition. In both cases, the investigation will include a review of any previous tests, subsequent tests and/or results of endocrine investigations. If previous tests are not available, the Athlete shall undergo an endocrine investigation or be tested unannounced at least three times within a three month period. Failure of the Athlete to co-operate in the investigations will result in considering the Athlete’s Sample to contain a Prohibited Substance. 2. Other Anabolic Agents Clenbuterol, zeranol. For purposes of this section: * “exogenous” refers to a substance which is not capable of being produced by the body naturally. ** “endogenous” refers to a substance which is capable of being produced by the body naturally. # an "analogue" is defined as "a substance derived from the modification or alteration of the chemical structure of another substance while retaining a similar pharmacological effect.” The Prohibited List 2004 25 November 2003 3 S5. PEPTIDE HORMONES The following substances are prohibited, including their mimetics*, analogues# and releasing factors: 1. Erythropoietin (EPO) 2. Growth hormone (hGH) and Insulin-like Growth Factor (IGF-1) 3. Chorionic Gonadotrophin (hCG) prohibited in males only; 4. Pituitary and synthetic gonadotrophins (LH) prohibited in males only; 5. Insulin. 6. Corticotrophins Unless the Athlete can demonstrate that the concentration was due to a physiological or pathological condition, a Sample will be deemed to contain a Prohibited Substance (as listed above) where the concentration of the Prohibited Substance or its metabolites and/or relevant ratios or markers in the Athlete’s Sample so exceeds the range of values normally found in humans so as not to be consistent with normal endogenous production. The presence of analogues, mimetics, diagnostic marker(s) or releasing factors of a hormone listed above or of any other finding which indicate(s) that the substance detected is not the naturally present hormone, will be reported as an adverse analytical finding. For purposes of this section: * a “mimetic” is defined as a substance with pharmacological effect similar to that of another substance, regardless of the fact that it has a different chemical structure. # an "analogue" is defined as "a substance derived from the modification or alteration of the chemical structure of another substance while retaining a similar pharmacological effect.” The Prohibited List 2004 25 November 2003 4 S6. BETA-2 AGONISTS All beta-2 agonists including their D- and L- isomers are prohibited except that formoterol, salbutamol, salmeterol and terbutaline are permitted by inhalation only to prevent and/or treat asthma and exercise-induced asthma/broncho-constriction. A medical notification in accordance with section 8 of the International Standard for Therapeutic Use Exemptions is required. Despite the granting of a TUE, when the Laboratory has reported a concentration of salbutamol (free plus glucuronide) greater than 1000 ng/mL, this will be considered as an adverse analytical finding unless the athlete proves that the abnormal result was the consequence of the therapeutic use of inhaled salbutamol. S7. AGENTS WITH ANTI-OESTROGENIC ACTIVITY Aromatase inhibitors, clomiphene, cyclofenil, tamoxifen are prohibited only in males. S8. MASKING AGENTS Masking agents are prohibited. They are products that have the potential to impair the excretion of Prohibited Substances, to conceal their presence in urine or other Samples used in doping control, or to change haematological parameters. Masking agents include but are not limited to: Diuretics*, epitestosterone, probenecid, plasma expanders (e.g. dextran, hydroxyethyl starch.) *A medical approval in accordance with section 7 of the International Standard for Therapeutic Use Exemptions is not valid if an Athlete’s urine contains a diuretic in association with threshold or sub-threshold levels of a Prohibited Substance(s). Diuretics include : acetazolamide, amiloride, bumetanide, canrenone, chlortalidone, etacrynic acid, furosemide, indapamide, mersalyl, spironolactone, thiazides (e.g. bendroflumethiazide, chlorothiazide, hydrochlorothiazide) and triamterene, and other substances with similar chemical structure or similar pharmacological effects. S.9 GLUCOCORTICOSTEROIDS Glucocorticosteroids are prohibited when administered orally, rectally, or by intravenous or intramuscular administration. All other administration routes require a medical notification in accordance with section 8 of the International Standard for Therapeutic Use Exemptions. The Prohibited List 2004 25 November 2003 5 PROHIBITED METHODS M1. ENHANCEMENT OF OXYGEN TRANSFER The following are prohibited: a. Blood doping. Blood doping is the use of autologous, homologous or heterologous blood or red blood cell products of any origin, other than for legitimate medical treatment. b. The Use of products that enhance the uptake, transport or delivery of oxygen, e.g. erythropoietins, modified haemoglobin products including but not limited to haemoglobin-based blood substitutes, microencapsulated haemoglobin products, perfluorochemicals, and efaproxiral (RSR13). M2. PHARMACOLOGICAL, CHEMICAL AND PHYSICAL MANIPULATION Pharmacological, chemical and physical manipulation is the Use of substances and methods, including masking agents, which alter, attempt to alter or may reasonably be expected to alter the integrity and validity of specimens collected in doping controls. These include but are not limited to catheterisation, urine substitution and/or tampering, inhibition of renal excretion and alterations of testosterone and epitestosterone concentrations. M3. GENE DOPING Gene or cell doping is defined as the non-therapeutic use of genes, genetic elements and/or cells that have the capacity to enhance athletic performance. The Prohibited List 2004 25 November 2003 6 SUBSTANCES AND METHODS PROHIBITED IN- AND OUT-OF-COMPETITION PROHIBITED SUBSTANCES (All categories listed hereunder refer to all those substances and methods listed in the relevant section) S4. ANABOLIC AGENTS S5. PEPTIDE HORMONES S6. BETA-2 AGONISTS* S7. AGENTS WITH ANTI-OESTROGENIC ACTIVITY S8. MASKING AGENTS (*Only clenbuterol, and salbutamol when its concentration in urine is greater than 1000ng/mL) PROHIBITED METHODS M1. ENHANCEMENT OF OXYGEN TRANSFER M2. PHARMACOLOGICAL, CHEMICAL AND PHYSICAL MANIPULATION M3. GENE DOPING SUBSTANCES PROHIBITED IN PARTICULAR SPORTS P.1 ALCOHOL Alcohol (ethanol) is prohibited in-Competition only, in the following sports. Detection will be conducted by breath analysis and/or blood. The doping violation threshold for each Federation is reported in parenthesis. If no threshold is indicated, the presence of any quantity of alcohol shall constitute a doping violation. Aeronautic (FAI) (0.20 g/L) Archery (FITA) (0.10 g/L) Automobile (FIA) Billiards (WCBS) Boules (CMSB) (0.50 g/L) The Prohibited List 2004 25 November 2003 7 Football (FIFA) Gymnastics (FIG) (0.10 g/L) Karate (WKF) (0.40 g/L) Modern Pentathlon (UIPM) (0.10 g/L) for the modern pentathlon discipline Motorcycling (FIM) Roller Sports (FIRS) (0.02 g/L) Skiing (FIS) Triathlon (ITU) (0.40 g/L) Wrestling (FILA) P.2 BETA-BLOCKERS Unless otherwise specified, beta-blockers are prohibited in-Competition only, in the following sports. Aeronautic (FAI) Archery (FITA) (also prohibited out of competition) Automobile (FIA) Billiards (WCBS) Bobsleigh (FIBT) Boules (CMSB) Bridge (FMB) Chess (FIDE) Curling (WCF) Football (FIFA) Gymnastics (FIG) Motorcycling (FIM) Modern Pentathlon (UIPM) for the modern pentathlon discipline Nine-pin bowling (FIQ) Sailing (ISAF) match race helms only Shooting (ISSF) (also prohibited out of competition) Skiing (FIS) ski jumping & free style snow board Swimming (FINA) in diving & synchronised swimming Wrestling (FILA) Beta-blockers include, but are not limited to, the following: acebutolol, alprenolol, atenolol, betaxolol, bisoprolol, bunolol, carteolol, carvedilol, celiprolol, esmolol, labetalol, levobunolol, metipranolol, metoprolol, nadolol, oxprenolol, pindolol, propranolol, sotalol, timolol. The Prohibited List 2004 25 November 2003 8 P.3 DIURETICS Diuretics are prohibited in- and out- of competition in all sports as masking agents. However, in the following weight-classified sports and sports where weight loss can enhance performance, no Therapeutic Use Exemptions shall be granted for use of diuretics. Body-Building (IFBB) Boxing (AIBA) Judo (IJF) Karate (WKF) Powerlifting (IPF) Rowing (Light-Weight) (FISA) Skiing (FIS) for Ski Jumping only Taekwondo (WTF) Weightlifting (IWF) Wrestling (FILA) Wushu (IWUF) SPECIFIED SUBSTANCES* “Specified Substances” are listed below: Stimulants: ephedrine, L-methylamphetamine, methylephedrine. Cannabinoids. Inhaled Beta-2 Agonists (except clenbuterol). Diuretics (this does not apply to section P3). Masking Agents: probenecid. Glucocorticosteroids Beta Blockers Alcohol *; The WADA Code (10.3) states “The Prohibited List may identify specified substances which are particularly susceptible to unintentional anti-doping rule violations because of their general availability in medicinal products or which are less likely to be successfully abused as doping agents.” A doping violation involving such substances may result in a reduced sanction as noted in the Code provided that the “…Athlete can establish that the Use of such a specified substance was not intended to enhance sport performance…” The Prohibited List 2004 25 November 2003 9 THE 2004 PROHIBITED LIST S3. CANNABINOIDS Stimulants: ephedrine, L-methylamphetamine, methylephedrine. Cannabinoids. Inhaled Beta-2 Agonists (except clenbuterol). Diuretics (this does not apply to section P3). Masking Agents: probenecid. Beta Blockers Alcohol

  • wada_2005_prohibited_list.pdf
    The World Anti-Doping Code THE 2005 PROHIBITED LIST INTERNATIONAL STANDARD The official text of the Prohibited List shall be maintained by WADA and shall be published in English and French. In the event of any conflict between the English and French versions, the English version shall prevail. This List shall come into effect on 1 January 2005. THE 2005 PROHIBITED LIST WORLD ANTI-DOPING CODE Valid 1 January 2005 The use of any drug should be limited to medically justified indications SUBSTANCES AND METHODS PROHIBITED AT ALL TIMES (IN- AND OUT-OF-COMPETITION) PROHIBITED SUBSTANCES S1. ANABOLIC AGENTS Anabolic agents are prohibited. 1. Anabolic Androgenic Steroids (AAS) a. Exogenous* AAS, including: 18α-homo-17β-hydroxyestr-4-en-3-one; bolasterone; boldenone; boldione; calusterone; clostebol; danazol; dehydrochloromethyl- testosterone; delta1-androstene-3,17-dione; delta1-androstenediol; delta1-dihydro-testosterone; drostanolone; ethylestrenol; fluoxymesterone; formebolone; furazabol; gestrinone; 4-hydroxytestosterone; 4-hydroxy-19-nortestosterone; mestanolone; mesterolone; metenolone; methandienone; methandriol; methyldienolone; methyltrienolone; methyltestosterone; mibolerone; nandrolone; 19-norandrostenediol; 19-norandrostenedione; norbolethone; norclostebol; norethandrolone; oxabolone; oxandrolone; oxymesterone; oxymetholone; quinbolone; stanozolol; stenbolone; tetrahydrogestrinone; trenbolone and other substances with a similar chemical structure or similar biological effect(s). b. Endogenous** AAS: androstenediol (androst-5-ene-3β,17β-diol); androstenedione (androst-4- ene-3,17-dione); dehydroepiandrosterone (DHEA); dihydrotestosterone; testosterone. The Prohibited List 2005 1 23 September 2004 and the following metabolites and isomers: 5α-androstane-3α,17α-diol; 5α-androstane-3α,17β-diol; 5α-androstane- 3β,17α-diol;, 5α-androstane-3β,17β-diol; androst-4-ene-3α,17α-diol; androst-4-ene-3α,17β-diol; androst-4-ene-3β,17α-diol; androst-5-ene- 3α,17α-diol; androst-5-ene-3α,17β-diol; androst-5-ene-3β,17α-diol; 4-androstenediol (androst-4-ene-3β,17β-diol); 5-androstenedione (androst-5-ene-3,17-dione); epi-dihydrotestosterone; 3α-hydroxy-5α- androstan-17-one; 3β-hydroxy-5α-androstan-17-one; 19-norandrosterone; 19-noretiocholanolone. Where a Prohibited Substance (as listed above) is capable of being produced by the body naturally, a Sample will be deemed to contain such Prohibited Substance where the concentration of the Prohibited Substance or its metabolites or markers and/or any other relevant ratio(s) in the Athlete’s Sample so deviates from the range of values normally found in humans that it is unlikely to be consistent with normal endogenous production. A Sample shall not be deemed to contain a Prohibited Substance in any such case where the Athlete proves by evidence that the concentration of the Prohibited Substance or its metabolites or markers and/or the relevant ratio(s) in the Athlete’s Sample is attributable to a physiological or pathological condition. In all cases, and at any concentration, the laboratory will report an Adverse Analytical Finding if, based on any reliable analytical method, it can show that the Prohibited Substance is of exogenous origin. If the laboratory result is not conclusive and no concentration as referred to in the above paragraph is found, the relevant Anti-Doping Organization shall conduct a further investigation if there are serious indications, such as a comparison to reference steroid profiles, for a possible Use of a Prohibited Substance. If the laboratory has reported the presence of a T/E ratio greater than four (4) to one (1) in the urine, further investigation is obligatory in order to determine whether the ratio is due to a physiological or pathological condition, except if the laboratory reports an Adverse Analytical Finding based on any reliable analytical method, showing that the Prohibited Substance is of exogenous origin. In case of an investigation, it will include a review of any previous and/or subsequent tests. If previous tests are not available, the Athlete shall be tested unannounced at least three times within a three month period. Should an Athlete fail to cooperate in the investigations, the Athlete’s Sample shall be deemed to contain a Prohibited Substance. The Prohibited List 2005 2 23 September 2004 2. Other Anabolic Agents, including but not limited to: Clenbuterol, zeranol, zilpaterol. For purposes of this section: * “exogenous” refers to a substance which is not capable of being produced by the body naturally. ** “endogenous” refers to a substance which is capable of being produced by the body naturally. S2. HORMONES AND RELATED SUBSTANCES The following substances, including other substances with a similar chemical structure or similar biological effect(s), and their releasing factors, are prohibited: 1. Erythropoietin (EPO); 2. Growth Hormone (hGH), Insulin-like Growth Factor (IGF-1), Mechano Growth Factors (MGFs); 3. Gonadotrophins (LH, hCG); 4. Insulin; 5. Corticotrophins. Unless the Athlete can demonstrate that the concentration was due to a physiological or pathological condition, a Sample will be deemed to contain a Prohibited Substance (as listed above) where the concentration of the Prohibited Substance or its metabolites and/or relevant ratios or markers in the Athlete’s Sample so exceeds the range of values normally found in humans so that it is unlikely to be consistent with normal endogenous production. The presence of other substances with a similar chemical structure or similar biological effect(s), diagnostic marker(s) or releasing factors of a hormone listed above or of any other finding which indicate(s) that the substance detected is of exogenous origin, will be reported as an Adverse Analytical Finding. S3. BETA-2 AGONISTS All beta-2 agonists including their D- and L-isomers are prohibited. Their use requires a Therapeutic Use Exemption. As an exception, formoterol, salbutamol, salmeterol and terbutaline, when administered by inhalation to prevent and/or treat asthma and exercise-induced asthma/broncho-constriction require an abbreviated Therapeutic Use Exemption. The Prohibited List 2005 3 23 September 2004 Despite the granting of a Therapeutic Use Exemption, when the Laboratory has reported a concentration of salbutamol (free plus glucuronide) greater than 1000 ng/mL, this will be considered as an Adverse Analytical Finding unless the athlete proves that the abnormal result was the consequence of the therapeutic use of inhaled salbutamol. S4. AGENTS WITH ANTI-ESTROGENIC ACTIVITY The following classes of anti-estrogenic substances are prohibited: 1. Aromatase inhibitors including, but not limited to, anastrozole, letrozole, aminogluthetimide, exemestane, formestane, testolactone. 2. Selective Estrogen Receptor Modulators (SERMs) including, but not limited to, raloxifene, tamoxifen, toremifene. 3. Other anti-estrogenic substances including, but not limited to, clomiphene, cyclofenil, fulvestrant. S5. DIURETICS AND OTHER MASKING AGENTS Diuretics and other masking agents are prohibited. Masking agents include but are not limited to: Diuretics*, epitestosterone, probenecid, alpha-reductase inhibitors (e.g. finasteride, dutasteride), plasma expanders (e.g. albumin, dextran, hydroxyethyl starch). Diuretics include: acetazolamide, amiloride, bumetanide, canrenone, chlortalidone, etacrynic acid, furosemide, indapamide, metolazone, spironolactone, thiazides (e.g. bendroflumethiazide, chlorothiazide, hydrochlorothiazide), triamterene, and other substances with a similar chemical structure or similar biological effect(s). * A Therapeutic Use Exemption is not valid if an Athlete’s urine contains a diuretic in association with threshold or sub-threshold levels of a Prohibited Substance(s). The Prohibited List 2005 4 23 September 2004 PROHIBITED METHODS M1. ENHANCEMENT OF OXYGEN TRANSFER The following are prohibited: a. Blood doping, including the use of autologous, homologous or heterologous blood or red blood cell products of any origin, other than for medical treatment. b. Artificially enhancing the uptake, transport or delivery of oxygen, including but not limited to perfluorochemicals, efaproxiral (RSR13) and modified haemoglobin products (e.g. haemoglobin-based blood substitutes, microencapsulated haemoglobin products). M2. CHEMICAL AND PHYSICAL MANIPULATION The following is prohibited: Tampering, or attempting to tamper, in order to alter the integrity and validity of Samples collected in Doping Controls. These include but are not limited to intravenous infusions*, catheterisation, and urine substitution. * Except as a legitimate acute medical treatment, intravenous infusions are prohibited. M3. GENE DOPING The non-therapeutic use of cells, genes, genetic elements, or of the modulation of gene expression, having the capacity to enhance athletic performance, is prohibited. The Prohibited List 2005 5 23 September 2004 SUBSTANCES AND METHODS PROHIBITED IN-COMPETITION In addition to the categories S1 to S5 and M1 to M3 defined above, the following categories are prohibited in competition: PROHIBITED SUBSTANCES S6. STIMULANTS The following stimulants are prohibited, including both their optical (D- and L-) isomers where relevant: Adrafinil, amfepramone, amiphenazole, amphetamine, amphetaminil, benzphetamine, bromantan, carphedon, cathine*, clobenzorex, cocaine, dimethylamphetamine, ephedrine**, etilamphetamine, etilefrine, famprofazone, fencamfamin, fencamine, fenetylline, fenfluramine, fenproporex, furfenorex, mefenorex, mephentermine, mesocarb, methamphetamine, methylamphetamine, methylenedioxyamphetamine, methylenedioxymethamphetamine, methylephedrine**, methylphenidate, modafinil, nikethamide, norfenfluramine, parahydroxyamphetamine, pemoline, phendimetrazine, phenmetrazine, phentermine, prolintane, selegiline, strychnine, and other substances with a similar chemical structure or similar biological effect(s)***. * Cathine is prohibited when its concentration in urine is greater than 5 micrograms per milliliter. ** Each of ephedrine and methylephedrine is prohibited when its concentration in urine is greater than 10 micrograms per milliliter. *** The substances included in the 2005 Monitoring Program (bupropion, caffeine, phenylephrine, phenylpropanolamine, pipradrol, pseudoephedrine, synephrine) are not considered as Prohibited Substances. NOTE: Adrenaline associated with local anaesthetic agents or by local administration (e.g. nasal, ophthalmologic) is not prohibited. The Prohibited List 2005 6 23 September 2004 S7. NARCOTICS The following narcotics are prohibited: buprenorphine, dextromoramide, diamorphine (heroin), fentanyl and its derivatives, hydromorphone, methadone, morphine, oxycodone, oxymorphone, pentazocine, pethidine. S8. CANNABINOIDS Cannabinoids (e.g. hashish, marijuana) are prohibited. S9. GLUCOCORTICOSTEROIDS All glucocorticosteroids are prohibited when administered orally, rectally, intravenously or intramuscularly. Their use requires a Therapeutic Use Exemption approval. All other routes of administration require an abbreviated Therapeutic Use Exemption. Dermatological preparations are not prohibited. The Prohibited List 2005 7 23 September 2004 SUBSTANCES PROHIBITED IN PARTICULAR SPORTS P1. ALCOHOL Alcohol (ethanol) is prohibited in-Competition only, in the following sports. Detection will be conducted by analysis of breath and/or blood. The doping violation threshold for each Federation is reported in parenthesis. • Aeronautic (FAI) (0.20 g/L) • Archery (FITA) (0.10 g/L) • Automobile (FIA) (0.10 g/L) • Billiards (WCBS) (0.20 g/L) • Boules (CMSB) (0.10 g/L) • Karate (WKF) (0.10 g/L) • Modern Pentathlon (UIPM) (0.10 g/L) for disciplines involving shooting • Motorcycling (FIM) (0.00 g/L) • Skiing (FIS) (0.10 g/L) P2. BETA-BLOCKERS Unless otherwise specified, beta-blockers are prohibited in-Competition only, in the following sports. • Aeronautic (FAI) • Archery (FITA) (also prohibited out-of-competition) • Automobile (FIA) • Billiards (WCBS) • Bobsleigh (FIBT) • Boules (CMSB) • Bridge (FMB) • Chess (FIDE) • Curling (WCF) • Gymnastics (FIG) • Motorcycling (FIM) • Modern Pentathlon (UIPM) for disciplines involving shooting • Nine-pin bowling (FIQ) • Sailing (ISAF) for match race helms only • Shooting (ISSF) (also prohibited out-of-competition) • Skiing (FIS) in ski jumping & free style snow board • Swimming (FINA) in diving & synchronised swimming • Wrestling (FILA) Beta-blockers include, but are not limited to, the following: acebutolol, alprenolol, atenolol, betaxolol, bisoprolol, bunolol, carteolol, carvedilol, celiprolol, esmolol, labetalol, levobunolol, metipranolol, metoprolol, nadolol, oxprenolol, pindolol, propranolol, sotalol, timolol. The Prohibited List 2005 8 23 September 2004 SPECIFIED SUBSTANCES* “Specified Substances”* are listed below: Ephedrine, L-methylamphetamine, methylephedrine; Cannabinoids; All inhaled Beta-2 Agonists, except clenbuterol; Probenecid; All Glucocorticosteroids; All Beta Blockers; Alcohol. * “The Prohibited List may identify specified substances which are particularly susceptible to unintentional anti-doping rule violations because of their general availability in medicinal products or which are less likely to be successfully abused as doping agents.” A doping violation involving such substances may result in a reduced sanction provided that the “…Athlete can establish that the Use of such a specified substance was not intended to enhance sport performance…” The Prohibited List 2005 9 23 September 2004 THE 2005 PROHIBITED LIST Ephedrine, L-methylamphetamine, methylephedrine; Cannabinoids; All inhaled Beta-2 Agonists, except clenbuterol; Probenecid; All Beta Blockers; Alcohol.

  • wada_2005_prohibited_list.pdf
    The World Anti-Doping Code THE 2005 PROHIBITED LIST INTERNATIONAL STANDARD The official text of the Prohibited List shall be maintained by WADA and shall be published in English and French. In the event of any conflict between the English and French versions, the English version shall prevail. This List shall come into effect on 1 January 2005. THE 2005 PROHIBITED LIST WORLD ANTI-DOPING CODE Valid 1 January 2005 The use of any drug should be limited to medically justified indications SUBSTANCES AND METHODS PROHIBITED AT ALL TIMES (IN- AND OUT-OF-COMPETITION) PROHIBITED SUBSTANCES S1. ANABOLIC AGENTS Anabolic agents are prohibited. 1. Anabolic Androgenic Steroids (AAS) a. Exogenous* AAS, including: 18α-homo-17β-hydroxyestr-4-en-3-one; bolasterone; boldenone; boldione; calusterone; clostebol; danazol; dehydrochloromethyl- testosterone; delta1-androstene-3,17-dione; delta1-androstenediol; delta1-dihydro-testosterone; drostanolone; ethylestrenol; fluoxymesterone; formebolone; furazabol; gestrinone; 4-hydroxytestosterone; 4-hydroxy-19-nortestosterone; mestanolone; mesterolone; metenolone; methandienone; methandriol; methyldienolone; methyltrienolone; methyltestosterone; mibolerone; nandrolone; 19-norandrostenediol; 19-norandrostenedione; norbolethone; norclostebol; norethandrolone; oxabolone; oxandrolone; oxymesterone; oxymetholone; quinbolone; stanozolol; stenbolone; tetrahydrogestrinone; trenbolone and other substances with a similar chemical structure or similar biological effect(s). b. Endogenous** AAS: androstenediol (androst-5-ene-3β,17β-diol); androstenedione (androst-4- ene-3,17-dione); dehydroepiandrosterone (DHEA); dihydrotestosterone; testosterone. The Prohibited List 2005 1 23 September 2004 and the following metabolites and isomers: 5α-androstane-3α,17α-diol; 5α-androstane-3α,17β-diol; 5α-androstane- 3β,17α-diol;, 5α-androstane-3β,17β-diol; androst-4-ene-3α,17α-diol; androst-4-ene-3α,17β-diol; androst-4-ene-3β,17α-diol; androst-5-ene- 3α,17α-diol; androst-5-ene-3α,17β-diol; androst-5-ene-3β,17α-diol; 4-androstenediol (androst-4-ene-3β,17β-diol); 5-androstenedione (androst-5-ene-3,17-dione); epi-dihydrotestosterone; 3α-hydroxy-5α- androstan-17-one; 3β-hydroxy-5α-androstan-17-one; 19-norandrosterone; 19-noretiocholanolone. Where a Prohibited Substance (as listed above) is capable of being produced by the body naturally, a Sample will be deemed to contain such Prohibited Substance where the concentration of the Prohibited Substance or its metabolites or markers and/or any other relevant ratio(s) in the Athlete’s Sample so deviates from the range of values normally found in humans that it is unlikely to be consistent with normal endogenous production. A Sample shall not be deemed to contain a Prohibited Substance in any such case where the Athlete proves by evidence that the concentration of the Prohibited Substance or its metabolites or markers and/or the relevant ratio(s) in the Athlete’s Sample is attributable to a physiological or pathological condition. In all cases, and at any concentration, the laboratory will report an Adverse Analytical Finding if, based on any reliable analytical method, it can show that the Prohibited Substance is of exogenous origin. If the laboratory result is not conclusive and no concentration as referred to in the above paragraph is found, the relevant Anti-Doping Organization shall conduct a further investigation if there are serious indications, such as a comparison to reference steroid profiles, for a possible Use of a Prohibited Substance. If the laboratory has reported the presence of a T/E ratio greater than four (4) to one (1) in the urine, further investigation is obligatory in order to determine whether the ratio is due to a physiological or pathological condition, except if the laboratory reports an Adverse Analytical Finding based on any reliable analytical method, showing that the Prohibited Substance is of exogenous origin. In case of an investigation, it will include a review of any previous and/or subsequent tests. If previous tests are not available, the Athlete shall be tested unannounced at least three times within a three month period. Should an Athlete fail to cooperate in the investigations, the Athlete’s Sample shall be deemed to contain a Prohibited Substance. The Prohibited List 2005 2 23 September 2004 2. Other Anabolic Agents, including but not limited to: Clenbuterol, zeranol, zilpaterol. For purposes of this section: * “exogenous” refers to a substance which is not capable of being produced by the body naturally. ** “endogenous” refers to a substance which is capable of being produced by the body naturally. S2. HORMONES AND RELATED SUBSTANCES The following substances, including other substances with a similar chemical structure or similar biological effect(s), and their releasing factors, are prohibited: 1. Erythropoietin (EPO); 2. Growth Hormone (hGH), Insulin-like Growth Factor (IGF-1), Mechano Growth Factors (MGFs); 3. Gonadotrophins (LH, hCG); 4. Insulin; 5. Corticotrophins. Unless the Athlete can demonstrate that the concentration was due to a physiological or pathological condition, a Sample will be deemed to contain a Prohibited Substance (as listed above) where the concentration of the Prohibited Substance or its metabolites and/or relevant ratios or markers in the Athlete’s Sample so exceeds the range of values normally found in humans so that it is unlikely to be consistent with normal endogenous production. The presence of other substances with a similar chemical structure or similar biological effect(s), diagnostic marker(s) or releasing factors of a hormone listed above or of any other finding which indicate(s) that the substance detected is of exogenous origin, will be reported as an Adverse Analytical Finding. S3. BETA-2 AGONISTS All beta-2 agonists including their D- and L-isomers are prohibited. Their use requires a Therapeutic Use Exemption. As an exception, formoterol, salbutamol, salmeterol and terbutaline, when administered by inhalation to prevent and/or treat asthma and exercise-induced asthma/broncho-constriction require an abbreviated Therapeutic Use Exemption. The Prohibited List 2005 3 23 September 2004 Despite the granting of a Therapeutic Use Exemption, when the Laboratory has reported a concentration of salbutamol (free plus glucuronide) greater than 1000 ng/mL, this will be considered as an Adverse Analytical Finding unless the athlete proves that the abnormal result was the consequence of the therapeutic use of inhaled salbutamol. S4. AGENTS WITH ANTI-ESTROGENIC ACTIVITY The following classes of anti-estrogenic substances are prohibited: 1. Aromatase inhibitors including, but not limited to, anastrozole, letrozole, aminogluthetimide, exemestane, formestane, testolactone. 2. Selective Estrogen Receptor Modulators (SERMs) including, but not limited to, raloxifene, tamoxifen, toremifene. 3. Other anti-estrogenic substances including, but not limited to, clomiphene, cyclofenil, fulvestrant. S5. DIURETICS AND OTHER MASKING AGENTS Diuretics and other masking agents are prohibited. Masking agents include but are not limited to: Diuretics*, epitestosterone, probenecid, alpha-reductase inhibitors (e.g. finasteride, dutasteride), plasma expanders (e.g. albumin, dextran, hydroxyethyl starch). Diuretics include: acetazolamide, amiloride, bumetanide, canrenone, chlortalidone, etacrynic acid, furosemide, indapamide, metolazone, spironolactone, thiazides (e.g. bendroflumethiazide, chlorothiazide, hydrochlorothiazide), triamterene, and other substances with a similar chemical structure or similar biological effect(s). * A Therapeutic Use Exemption is not valid if an Athlete’s urine contains a diuretic in association with threshold or sub-threshold levels of a Prohibited Substance(s). The Prohibited List 2005 4 23 September 2004 PROHIBITED METHODS M1. ENHANCEMENT OF OXYGEN TRANSFER The following are prohibited: a. Blood doping, including the use of autologous, homologous or heterologous blood or red blood cell products of any origin, other than for medical treatment. b. Artificially enhancing the uptake, transport or delivery of oxygen, including but not limited to perfluorochemicals, efaproxiral (RSR13) and modified haemoglobin products (e.g. haemoglobin-based blood substitutes, microencapsulated haemoglobin products). M2. CHEMICAL AND PHYSICAL MANIPULATION The following is prohibited: Tampering, or attempting to tamper, in order to alter the integrity and validity of Samples collected in Doping Controls. These include but are not limited to intravenous infusions*, catheterisation, and urine substitution. * Except as a legitimate acute medical treatment, intravenous infusions are prohibited. M3. GENE DOPING The non-therapeutic use of cells, genes, genetic elements, or of the modulation of gene expression, having the capacity to enhance athletic performance, is prohibited. The Prohibited List 2005 5 23 September 2004 SUBSTANCES AND METHODS PROHIBITED IN-COMPETITION In addition to the categories S1 to S5 and M1 to M3 defined above, the following categories are prohibited in competition: PROHIBITED SUBSTANCES S6. STIMULANTS The following stimulants are prohibited, including both their optical (D- and L-) isomers where relevant: Adrafinil, amfepramone, amiphenazole, amphetamine, amphetaminil, benzphetamine, bromantan, carphedon, cathine*, clobenzorex, cocaine, dimethylamphetamine, ephedrine**, etilamphetamine, etilefrine, famprofazone, fencamfamin, fencamine, fenetylline, fenfluramine, fenproporex, furfenorex, mefenorex, mephentermine, mesocarb, methamphetamine, methylamphetamine, methylenedioxyamphetamine, methylenedioxymethamphetamine, methylephedrine**, methylphenidate, modafinil, nikethamide, norfenfluramine, parahydroxyamphetamine, pemoline, phendimetrazine, phenmetrazine, phentermine, prolintane, selegiline, strychnine, and other substances with a similar chemical structure or similar biological effect(s)***. * Cathine is prohibited when its concentration in urine is greater than 5 micrograms per milliliter. ** Each of ephedrine and methylephedrine is prohibited when its concentration in urine is greater than 10 micrograms per milliliter. *** The substances included in the 2005 Monitoring Program (bupropion, caffeine, phenylephrine, phenylpropanolamine, pipradrol, pseudoephedrine, synephrine) are not considered as Prohibited Substances. NOTE: Adrenaline associated with local anaesthetic agents or by local administration (e.g. nasal, ophthalmologic) is not prohibited. The Prohibited List 2005 6 23 September 2004 S7. NARCOTICS The following narcotics are prohibited: buprenorphine, dextromoramide, diamorphine (heroin), fentanyl and its derivatives, hydromorphone, methadone, morphine, oxycodone, oxymorphone, pentazocine, pethidine. S8. CANNABINOIDS Cannabinoids (e.g. hashish, marijuana) are prohibited. S9. GLUCOCORTICOSTEROIDS All glucocorticosteroids are prohibited when administered orally, rectally, intravenously or intramuscularly. Their use requires a Therapeutic Use Exemption approval. All other routes of administration require an abbreviated Therapeutic Use Exemption. Dermatological preparations are not prohibited. The Prohibited List 2005 7 23 September 2004 SUBSTANCES PROHIBITED IN PARTICULAR SPORTS P1. ALCOHOL Alcohol (ethanol) is prohibited in-Competition only, in the following sports. Detection will be conducted by analysis of breath and/or blood. The doping violation threshold for each Federation is reported in parenthesis. • Aeronautic (FAI) (0.20 g/L) • Archery (FITA) (0.10 g/L) • Automobile (FIA) (0.10 g/L) • Billiards (WCBS) (0.20 g/L) • Boules (CMSB) (0.10 g/L) • Karate (WKF) (0.10 g/L) • Modern Pentathlon (UIPM) (0.10 g/L) for disciplines involving shooting • Motorcycling (FIM) (0.00 g/L) • Skiing (FIS) (0.10 g/L) P2. BETA-BLOCKERS Unless otherwise specified, beta-blockers are prohibited in-Competition only, in the following sports. • Aeronautic (FAI) • Archery (FITA) (also prohibited out-of-competition) • Automobile (FIA) • Billiards (WCBS) • Bobsleigh (FIBT) • Boules (CMSB) • Bridge (FMB) • Chess (FIDE) • Curling (WCF) • Gymnastics (FIG) • Motorcycling (FIM) • Modern Pentathlon (UIPM) for disciplines involving shooting • Nine-pin bowling (FIQ) • Sailing (ISAF) for match race helms only • Shooting (ISSF) (also prohibited out-of-competition) • Skiing (FIS) in ski jumping & free style snow board • Swimming (FINA) in diving & synchronised swimming • Wrestling (FILA) Beta-blockers include, but are not limited to, the following: acebutolol, alprenolol, atenolol, betaxolol, bisoprolol, bunolol, carteolol, carvedilol, celiprolol, esmolol, labetalol, levobunolol, metipranolol, metoprolol, nadolol, oxprenolol, pindolol, propranolol, sotalol, timolol. The Prohibited List 2005 8 23 September 2004 SPECIFIED SUBSTANCES* “Specified Substances”* are listed below: Ephedrine, L-methylamphetamine, methylephedrine; Cannabinoids; All inhaled Beta-2 Agonists, except clenbuterol; Probenecid; All Glucocorticosteroids; All Beta Blockers; Alcohol. * “The Prohibited List may identify specified substances which are particularly susceptible to unintentional anti-doping rule violations because of their general availability in medicinal products or which are less likely to be successfully abused as doping agents.” A doping violation involving such substances may result in a reduced sanction provided that the “…Athlete can establish that the Use of such a specified substance was not intended to enhance sport performance…” The Prohibited List 2005 9 23 September 2004 THE 2005 PROHIBITED LIST Ephedrine, L-methylamphetamine, methylephedrine; Cannabinoids; All inhaled Beta-2 Agonists, except clenbuterol; Probenecid; All Beta Blockers; Alcohol.

  • wada_2006_list_modifications.pdf
    1 September 2005 WADA Prohibited List, 2006 Summary of Major Modifications SUBSTANCES AND METHODS PROHIBITED AT ALL TIMES (IN- AND OUT-OF-COMPETITION) S1. ANABOLIC STEROIDS The nomenclature of the substances on this list of examples is standardized as follows: • For substances that have been given an International Non-proprietary Name (INN), only this name appears. • Only when the commonly-used name of a substance is better known than the INN, this commonly-used name appears in parenthesis. • When the INN is not known, the commonly-used name appears, accompanied by the International Union of Pure and Applied Chemistry (IUPAC) nomenclature in parenthesis. 1.a. Exogenous Anabolic Steroids • Desoxymethyltestosterone (designer steroid), methasterone, prostanozol and methyl-1-testosterone are added to the list of examples. 1.b. Endogenous Anabolic Steroids • The explanatory note in Section 1b: “Endogenous AAS” has been reworded and expanded in order to further clarify the procedures and/or tests to follow when an Adverse Analytical Finding is reported for this category of anabolic androgenic steroids or for a T/E ratio. • An explanatory paragraph previously included in the Explanatory Note of the 2005 Prohibited List is added to clarify the procedures for the follow-up tests after reporting an Adverse Analytical Finding of a very low concentration of boldenone. • It is also specified, as described in the Explanatory Note of the 2005 List, that an Adverse Analytical Finding for 19-norandrosterone 2 reported by a laboratory is sufficient proof and does not require further follow-up tests. Other Anabolic Agents: • Tibolone, a synthetic steroid with anabolic properties used to treat post-menopausal symptoms, is added to the list of examples. S.2 HORMONES AND RELATED SUBSTANCES • The status of both human chorionic gonadotrophin (hCG) and luteinizing hormone (LH) is changed and both substances are now only prohibited in males. Despite the scientific rationale to prohibit these substances in women, the experience during 2005 has led, in some cases, to detect elevated hCG levels due to physiological (pregnancy) or pathological conditions with potentially significant psychological or social consequences for the athlete, in addition to the difficulty, to date, to discriminate at the laboratory level these cases from doping abuse. • A paragraph reinforcing the detection of exogenous substances by a reliable method is added for consistency with that of endogenous anabolic steroids in Section 1b. • “s” is added to “factor” in “insulin-like growth factor” since there is more than one. S.3 BETA-2 AGONISTS • The sentence “Their use requires a Therapeutic Use Exemption” in the first paragraph is deleted as it applies to all substances on the List and was deemed redundant with subsequent wording. • The mention of restricted diagnosis to use of beta-2-agonists by inhalation is deleted in order to be consistent with Section 8 of the Therapeutic Use Exemption Standard and as it is preferred to leave to the professional judgment of the physician the medical conditions under which these drugs have to be prescribed. • The last paragraph of this section is slightly reworded to stress that a concentration of salbutamol greater than 1000 ng/mL is considered an adverse analytical finding regardless of the granting of any form of Therapeutic Use Exemption. S.5 DIURETICS 3 • The sentence “Diuretics and other masking agents are prohibited” is removed as it was deemed redundant with the rest of the paragraph. • It is clarified that drosperinone, a progestative with mild diuretic properties, is not prohibited (as indicated in the Explanatory Note of the 2005 Prohibited List). M1. ENHANCEMENT OF OXYGEN TRANSFER • “…other than for medical treatment” is removed from the end of paragraph “a” as it is deemed unnecessary and ambiguous. M2. CHEMICAL AND PHYSICAL MANIPULATION • The section is divided into 2 separate subcategories to avoid confusion between tampering methods used during sample collection and intravenous infusions. SUBSTANCES AND METHODS PROHIBITED IN-COMPETITION S.6 STIMULANTS • Adrenaline, which previously was exemplified in a footnote only, is now clearly named in the list of stimulants. • Some stimulants considered prohibited but not previously listed as examples in the 2004 and 2005 List, are re-introduced to the list of examples for clarification. Therefore cropropamide, crotetamide, etamivan, heptaminol, isometheptene, and the isomers of methylamphetamine (levmethamfetamine, methamphetamine (D-), p- methylamphetamine, ortetamine, phenpromethamine, propylhexedrine) are re-introduced as examples. • New examples of stimulants are added based on chemical structure or biological effect(s): cyclazodone, fenbutrazate, meclofenoxate, norfenefrine, octopamine, oxilofrine, pentetrazol, sibutramine. • Please note that a number of new stimulants added to the section are also specified substances as indicated in the corresponding section. S9. GLUCOCORTICOSTEROIDS • Topical preparations, to treat aural/otic, nasal, buccal cavity and ophthalmic ailments, no longer require a Therapeutic Use Exemption 4 due to a wide medical use and the absence of doping potential for these routes of administration. SUBSTANCES PROHIBITED IN PARTICULAR SPORTS P1. ALCOHOL • FIS requested to be removed from the list of International Federations testing for alcohol. • Powerboating (UIM) is added with a threshold at 0.30g/L. • International Paralympic Committee (IPC) is added for Archery and Boules (bowls). • FIM requested to change the threshold level from 0.00 g/L to 0.10 g/L. P2. BETA BLOCKERS • FINA requested to have prohibition lifted. • IPC is added for Archery, Shooting and Boules (bowls). • The list of different categories of FIS disciplines where beta-blockers are prohibited is expanded. SPECIFIED SUBSTANCES The following stimulants from section S6 are added: cathine, cropropamide, crotetamide, etamivan, famprofazone, heptaminol, isometheptene, meclofenoxate, p-methylamphetamine, nikethamide, norfenefrine, octopamine, ortetamine, oxilofrine, phenpromethamine, propylhexedrine, selegiline and sibutramine. MONITORING PROGRAM The following stimulants from Section S6 will be monitored out-of- competition: adrafinil, adrenaline, amfepramone, amiphenazole, amphetamine, amphetaminil, benzphetamine, bromantan, carphedon, clobenzorex, cocaine, cyclazodone, dimethylamphetamine, etilamphetamine, etilefrine, fenbutrazate, fencamfamin, fencamine, fenetylline, fenfluramine, fenproporex, furfenorex, mefenorex, mephentermine, mesocarb, methamphetamine (D-), methylenedioxyamphetamine, methylenedioxymethamphetamine, methylphenidate, modafinil, norfenfluramine, parahydroxyamphetamine, pemoline, pentetrazol, phendimetrazine, phenmetrazine, phentermine, prolintane, strychnine. The monitoring program for in-competition substances will remain as in 2005, with the recommendation to extend the number of laboratories 5 participating in this program in order to better monitor some trends observed for some substances.
  • keyboard_double_arrow_left
  • keyboard_arrow_left
  • …
  • 408
  • 409
  • 410
  • 411
  • 412
  • …
  • keyboard_arrow_right
  • keyboard_double_arrow_right
  • email
Zuletzt aktualisiert: 23.07.2026
  • Kontakt & Anfahrt
Soziale Medien
  • Impressum
  • Datenschutz
  • Barrierefreiheit
  • north_east Hinweis geben
Partneruniversität für Spitzensport Akkreditierungsrat Weltoffene Hochschulen gegen Fremdenfeindlichkeit Familie in der Hochschule Global Sport University Network Kölner Wissenschaftsrunde HR Excellence in Research